PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02852.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 435aa    MW: 48776.6 Da    PI: 7.7852
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02852.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073243572154
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              k +yp++e++++L +++gL+ +q+ +WF N+R +
  Rsa1.0_02852.1_g00006.1 324 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 357
                              469*****************************87 PP

2ELK28.82.8e-10278299122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELKh+L+++Y+++++++++E++
  Rsa1.0_02852.1_g00006.1 278 ELKHELKQGYKEKIVDIREEIL 299
                              9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.4E-19112156IPR005540KNOX1
PfamPF037909.7E-18115155IPR005540KNOX1
SMARTSM012561.8E-28169224IPR005541KNOX2
PfamPF037911.8E-20174223IPR005541KNOX2
PROSITE profilePS512139.969278298IPR005539ELK domain
SMARTSM011886.1E-4278299IPR005539ELK domain
PfamPF037891.0E-6278299IPR005539ELK domain
PROSITE profilePS5007111.726298361IPR001356Homeobox domain
SuperFamilySSF466895.56E-16300365IPR009057Homeodomain-like
SMARTSM003892.4E-11300365IPR001356Homeobox domain
CDDcd000861.13E-11301362No hitNo description
Gene3DG3DSA:1.10.10.603.0E-25305362IPR009057Homeodomain-like
PfamPF059201.2E-17318357IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MAFHHNHFNH FTDQQHQPPL PPPPQQQEHH FHESTPPNWL LRSDNNFLNL HTPASTVATS  60
SDSPSSAAAN QWLSRSSSFL QRGGGASNSN AGSGDAMENV TGGEESMIGE NGRQKAEILS  120
HPLYEQLLSA HVACLRIATP VDQLPRIDAQ LAQSQNVVAK YSTLDAASQG LVSGDDKELD  180
HFMTHYVLLL CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ SFTGVSPGEG TGATMSEDED  240
EQVESDAHLF DGSLDGLGFG PLVPTESERS LMERVRQELK HELKQGYKEK IVDIREEILR  300
KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE EDKARLVQET GLQLKQINNW FINQRKRNWH  360
SNPSSSTASK NKRKRVRMTN FCKKTKIPFK FEEPPLRWEG RVHSRGFGCG RRIFKVKRPV  420
GDYGGTKGVP GFAGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12301365872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354374RKRNWHSNPSSSTASKNKRKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533380.0AK353338.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-40-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622360.10.0PREDICTED: homeobox protein knotted-1-like 4 isoform X2
RefseqXP_013661885.10.0PREDICTED: homeobox protein knotted-1-like 4 isoform X2
SwissprotP480010.0KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLA0A0D3B0K30.0A0A0D3B0K3_BRAOL; Uncharacterized protein
STRINGBra006085.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.10.0KNOTTED1-like homeobox gene 4